Input now accepts multiple sequences
Multiple sequence alignment display available
The following sequence annotations will be attempted:
- Chothia, Martin, Kabat, AHo and IMGT numbering
- Identification of Loop and Framework regions
- Canonical class assignments for CDRs
- Identification of unusual residues
- Alignment to closest human or mouse germline sequences
- Human subgroup assignment
- Humanness assessment
|
|
Numbering & Regions
Calculating, please wait ...
Nothing to show.
Region Sequence Details
Accession & Annotations
Tools
Sequences
Amino Acid Sequence:
QVQLQESGGGLVQPGGSLRLSCAASGTIDNFNGMGWYRQAPGKQREWLARITMNGRTIYA ESVEGRFTISRDKVKNTLALQMNSLKPEDTAVYYCNARGVLTPRGIHDYWGQGTQVTVSS
|
Calculating, please wait ...
Nothing to show.
|
|
Calculating, please wait ...
Nothing to show.
|